Recombinant Human MHC Class I chain-related protein (MICA), partial (Active)

In Stock
Code: CSB-MP5605HU
Size:
20ug
20ug100ug1mg
US$104
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human MICA protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human MICA at 2 μg/mL can bind Anti-MICA/B recombinant antibody (CSB-RA56059MA1HU). The EC50 is 0.6924-0.9195 ng/mL.
Target Names
MICA
Uniprot NO.
Alternative Names
MHC Class I chain-related protein; MHC class I polypeptide-related sequence A; MICA
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-309aa
Target Protein Sequence
EPHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.1 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Human MICA at 2 μg/ml can bind Anti-MICA/B recombinant antibody (CSB-RA56059MA1HU). The EC50 is 0.6924-0.9195 ng/mL.
Description

MICA functions as a stress-induced ligand for the activating receptor NKG2D on natural killer cells and CD8+ T cells, making it a critical node in immune surveillance and tumor immunology. This mammalian-expressed construct spanning residues 24–309 captures the complete extracellular domain, preserving the native glycosylation and disulfide architecture required for physiological NKG2D engagement. Functional ELISA validation demonstrates specific antibody binding with an EC50 of 0.69–0.92 ng/mL, confirming conformational integrity suitable for therapeutic antibody epitope mapping, competitive inhibition screening of NKG2D-blocking biologics, and ligand-receptor interaction studies by surface plasmon resonance or biolayer interferometry. The protein meets the purity (>95% by SDS-PAGE) and endotoxin (<1.0 EU/μg) thresholds commonly required for cell-based assays investigating MICA shedding mechanisms, tumor immune evasion pathways, and antibody-dependent cellular cytotoxicity in NK cell activation models.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products